DPCstruct | MC5285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 96 ± 10 aa |
| Standard deviation of domain lengths | 9.81 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G7WT81 | 4-95 | MICKIDRYYNGDRLVIKFKDGMILSGVIDTIYETNNELDECDSEYQEYYACTFLVEKVIKTGQRDYQENDLIEISRFNEPCLILDAD… |
| A0A1V9IKF9 | 1-114 | MFSNELEEGLMRSLMSFFDENHNKSVIIEWKDGTKIKVLLDTFYETDNGLEIEECGYEEYYACAITIQKVINLPNELIQSISYPARS… |
| A0A1G6RNI4 | 2-90 | None |
| A0A5B6P2G7 | 20-123 | None |
| A0A5D6WNV2 | 2-77 | None |
| A0A662ZCE3 | 183-277 | None |
| A0A1Q6RU87 | 1-102 | None |
| I0GQK5 | 349-442 | None |
| A0A848D7L4 | 1-105 | None |
| A0A261FCJ2 | 2-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.