DPCstruct | MC52840
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 247 ± 46 aa |
| Standard deviation of domain lengths | 46.16 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03625 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A381NQN3 | 49-248 | LDMKGDMVYLSVPNIDYWGNIYLRDDFEKVGKAIGEFKADLPRLLPKLRGKFMRPFGATEPLTLEKLKTYRHSGRYPSRDEMIELGQ… |
| A0A151CG85 | 134-351 | NGFRVLAVTPILKDKIVLTITNDELQKTNTLLATLHVLVNVGDEVRVQNPSYFGAAYLQDKYKYGQFTETLKALQAALGDMYEVKEK… |
| A0A1F6UIR8 | 56-341 | None |
| A0A423PYU4 | 49-356 | None |
| A0A432TBN2 | 211-430 | None |
| A0A6S6SLH1 | 161-415 | None |
| A0A151CG12 | 812-1031 | None |
| A0A7V5KZP9 | 38-252 | None |
| A0A1I0P3N1 | 26-300 | None |
| A0L676 | 56-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.