DPCstruct | MC5284
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 83 ± 7 aa |
| Standard deviation of domain lengths | 6.89 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 47.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V9IDY5 | 16-97 | MKMAKCIKELERIYGIKKGNNQNSGSEIISEAKKSQEDLANQIGIDERQLRNYKKLNELIPELQSLVETGELKSTTAYKIWA |
| A0A645H7Z0 | 11-105 | QRGIGNTNPIKFARCIQELEKIYDVRNGSAGKRSLDGNNFPPKTQSDLAEQFGVSEKQLRNYKNLLTLVPELQDSIEQGILSPTVGY… |
| A0A0L6JHK9 | 1-72 | None |
| A0A3C0J8X5 | 16-108 | None |
| A0A1M6SA92 | 1-88 | None |
| A0A416JU90 | 1-72 | None |
| C1FTL3 | 1-80 | None |
| A0A6M1PG50 | 2-86 | None |
| A0A2Z2K6L7 | 1-89 | None |
| A0A1Q9PU80 | 4-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.