DPCstruct | MC52837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 132 ± 37 aa |
| Standard deviation of domain lengths | 36.56 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 78.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.78 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 46.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0413 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A809T4Z1 | 1-120 | MALPAFDRNGRSAGIWLNPLTTDDGNGLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGVVVRIAGEGRP… |
| A0A377YXY3 | 42-130 | RKYPQPYVALPAFDRNGRSAGIWLNPLTTDDGNGLRGFSGEGRVKGSGDAQFVALQGSRNGESLLAGNMGEGVRMARDNPIRGGGAA… |
| A0A4D0RC91 | 83-194 | None |
| A0A2T4XTT9 | 311-541 | None |
| A0A839LD21 | 8-120 | None |
| A0A8B4NDR7 | 123-261 | None |
| A0A8B4JMB3 | 42-180 | None |
| Q93GL4 | 1524-1649 | None |
| A0A5B9SWJ1 | 266-463 | None |
| A0A2A2GZF2 | 82-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.