DPCstruct | MC52828
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 105 ± 11 aa |
| Standard deviation of domain lengths | 11.23 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832SPF6 | 1-95 | DLKKVGIFLISFSIIMPTFNGIIGVVVATLIGLSMGGSVMFGLLLASASFIAAPAVLRNAIPQANPSLYITSALGITFPYNIIVLLP… |
| A0A7C2ITM6 | 1-93 | GALIGFGIVVPIVHGALGVLLGTWAGLSLGGSTVLGVMAASASYIAAPAAVRLALPEANPTLYLTASLGVTFPFNLGLGIPLFYQLA… |
| A0A2A3MKG6 | 34-146 | None |
| X8F336 | 19-119 | None |
| A0A7V8ZQR2 | 45-157 | None |
| A0A6J6I785 | 100-211 | None |
| A0A6C2YMA3 | 489-577 | None |
| W4RTI0 | 135-246 | None |
| A0A1Z4RJJ4 | 1-80 | None |
| A0A1Y1R1L6 | 97-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.