DPCstruct | MC52826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 106 ± 12 aa |
| Standard deviation of domain lengths | 12.46 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J2LT52 | 121-240 | GKIIYVGSRDITIDRNHPLAGKNILVHLKIHKVVLPSDPAPERLRMILERYLGEELTNKVKIDLGDRELEITFPTDILMRMSIRDLV… |
| A0A7K4DVJ5 | 1-93 | HRYAGKTILFDVNVIKSLESPSDKIDGILKNRLPVEDSKISFDLKDKEVNISIPEEILRADGLQIMKHFIQLDIFKFVPTLEKVSFV… |
| A0A5E4LMM9 | 61-184 | None |
| A0A5E4LKT8 | 127-254 | None |
| A0A2D6P2A2 | 91-209 | None |
| A0A846NA43 | 12-113 | None |
| A0A151ECT2 | 133-241 | None |
| A0A6V8DQY0 | 8-97 | None |
| A0A256YPW6 | 7-93 | None |
| A0A7J3T8G1 | 86-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.