DPCstruct | MC52821
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 74 ± 7 aa |
| Standard deviation of domain lengths | 7.32 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A268HX16 | 1-70 | TSRSGIEAVLASLIERGDRVLVPIYGRFGHLLVEICERYGADVHKIECTWGTVFSEEEVINHIHAIKPNI |
| A0A803VV96 | 103-170 | ISGSGHCAMEAALFNLLEQGDTVLVAINGIWGQRAADIARRLGANVYELLKPPGKYFTPQDIEQGLLQ |
| A0A0L0TFL5 | 74-144 | None |
| A0A380H231 | 42-127 | None |
| A0A538I2P4 | 291-354 | None |
| A0A3Q2QG70 | 72-158 | None |
| A0A444UDI8 | 437-506 | None |
| D7PC20 | 54-128 | None |
| K1TCZ0 | 60-130 | None |
| H3ENB9 | 94-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.