DPCstruct | MC5282
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 88 ± 11 aa |
| Standard deviation of domain lengths | 11.19 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 31.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M7SL06 | 1-81 | MIRNAVGMLPFVLMLVMLIMHLALPDKTFSKEERRYLAQWPVFHIEEVIDGSYGSKVESYFSDQFPFRNFWIQIEERLRGF |
| A0A1J0JGA9 | 6-91 | KKTHDNLLNIATIVPFIFILVMLILHLVLPDKTFSREEMRYLGQWPTFHVESVMNGNYKTKVESYFSDQFPLRNFWVHIQESSNKI |
| A0A1G4WHP2 | 132-216 | None |
| A0A2I0MZM2 | 1-91 | None |
| A0A356AUZ6 | 20-112 | None |
| A0A355JFU5 | 1-88 | None |
| A0A847BME6 | 78-169 | None |
| K0FRL9 | 1-106 | None |
| A0A351QU88 | 21-106 | None |
| G2FRG7 | 1-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.