DPCstruct | MC52816
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 197 ± 22 aa |
| Standard deviation of domain lengths | 22.05 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 70.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G5ACI1 | 4-182 | VHNIRCKEPINEIRASKRVLVVTFQDKICVYNACTFKERFCITGCFPVSGPNVNPIALHTRWLAFADKALFPVHQTRGGVAGEGTQS… |
| A0A553PUU1 | 1-188 | MVKSIQFKTPIYDLHCNKKILVVSLQEKIAAFDSCTFMKKFFVTSCYPCPGPNLNPIALGSRWLAYAENKLIRCHQSRGGACGDNAQ… |
| A0A7I8IFH8 | 100-328 | None |
| A0A0N5AGS7 | 238-447 | None |
| A0A0N4V4C5 | 230-421 | None |
| A0A6D2KLY5 | 160-372 | None |
| G3PK48 | 132-319 | None |
| A0A2G5ERZ6 | 154-396 | None |
| A0A3P6RVA0 | 44-225 | None |
| A0A6V7YF68 | 6-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.