DPCstruct | MC52813
Metacluster Properties and Pfam Annotations
| Number of structural domains | 200 |
|---|---|
| Mean domain length (aa) | 101 ± 16 aa |
| Standard deviation of domain lengths | 15.85 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13308 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V2MD47 | 18-115 | EHSIKLNSINYDYILPTSNIEYLTSEHITNLEPDSLRLARNEIFARHGYIFQSEELLSYFHTKSWYQPKINGIDFDMNILNPFEQYN… |
| A0A2K8X0E6 | 145-224 | DGEFPETSFVKLTIEELKDYPSDTLKIIRNEIFARHGHIFISGGKMEAYFLQKKWYSKTKTITPKDLSTIEKHNIDIIRR |
| A0A0J1G0T6 | 212-318 | None |
| A0A3A9GWJ6 | 646-747 | None |
| A0A660SIF2 | 28-133 | None |
| A0A5P8E729 | 132-227 | None |
| A0A1Y4F5K7 | 350-457 | None |
| A0A1Y4ET44 | 169-265 | None |
| A0A7Y7NNE9 | 300-390 | None |
| A0A2K2U251 | 327-431 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.