DPCstruct | MC5281
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 80 ± 7 aa |
| Standard deviation of domain lengths | 7.24 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 31.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0609 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2ENH5 | 3-75 | EIFSEKVVTNRRTYFFDVKETKEGAKYLVIGELTQIGSETERHRVMVFEESLDSFVDGMDKAIDFIRYGQARE |
| A0A661XH51 | 4-72 | VEIFSRRFKTQRGKTFFFDVKKNSNGKFVKITESIPQGNSNYRRAFMTVSEEALPEFIKTLEEIKQEME |
| A0A1G3M0Y2 | 51-134 | None |
| A0A016A9J8 | 170-251 | None |
| A0A7V0SSY8 | 1-69 | None |
| W5SMB8 | 21-99 | None |
| A0A7V2XT37 | 65-146 | None |
| A0A1H3XGL1 | 1-97 | None |
| A0A1G1YTY9 | 5-74 | None |
| A0A0M3CEJ5 | 1-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.