DPCstruct | MC52801
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 93 ± 13 aa |
| Standard deviation of domain lengths | 12.81 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11811 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q8IQ84 | 14-91 | VRIEILESSDTTLVIRWVEPGRCHYGEQRWRRRSAHSSGTCAVSRRKIRRGDAVFKPAERPAPSNASAMICAEILEPL |
| A0A3D8K796 | 10-100 | AQPLGNPSGTSPSCTVTIEERLENKRIALSWSDPTCGSYRGQLWRYAIAPKPGVCALSGQPIKRGDAIFRPQARSRNAPRNRNAMIL… |
| A0A2T0KKM7 | 119-236 | None |
| A0A7I8BY74 | 1-73 | None |
| A0A7X1NKB4 | 47-131 | None |
| A0A3N8KCV6 | 2-66 | None |
| A0A5E5BLV0 | 10-98 | None |
| X1QG13 | 4-75 | None |
| A0A2W7FKS1 | 40-143 | None |
| A0A2I8EZA7 | 83-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.