DPCstruct | MC5280
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 145 ± 7 aa |
| Standard deviation of domain lengths | 6.99 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5T578 | 58-202 | LRNFTLLVRRQGSGKVYPATIMGLTYQGKSFIAIAPYRAHNIVARGRSCGECHANAAIAEYARTGQITVTRWDEQQKKLIGPSGVIP… |
| A0A7C2CIW4 | 1-141 | MLLVRRQGSGKVYPATIMGLTYHGKSFIAIAPYRAHNIVAKGRSCSECHANAAITEYAQTGRITLTRWDEQQKKLIGPSGVIPVPPD… |
| A0A7C4ZB89 | 265-410 | None |
| A0A1G0THK1 | 216-362 | None |
| A0A7Y8J0U5 | 1-152 | None |
| A0A656DAE6 | 82-236 | None |
| A0A1E7H1L0 | 220-357 | None |
| A0A7C7Q047 | 129-278 | None |
| A0A496VPF8 | 341-468 | None |
| A0A2M6YY09 | 104-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.