DPCstruct | MC52797
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 247 ± 42 aa |
| Standard deviation of domain lengths | 42.16 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 73.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3DXJ0 | 9-295 | YESDTTSTLIFFITQEAMLIGYSSFLSALLVYGKLYFISDWTIIVFFAIHVVIGTSLYIFVFRYNVKLMTTMEKGADLGYSVFTKLA… |
| A0A2G5V1Q4 | 189-398 | RREKEAKIDLERKVERLEKEKYENELDLSSMDYDLKMAEADNRFLTYENEMLSDLTQQYFHSKEEQIKYKDRAKRQLRKRKQECKDL… |
| G0N7Y5 | 79-353 | None |
| G0MWW6 | 187-478 | None |
| G0MWY3 | 394-677 | None |
| G0N7Y6 | 1-188 | None |
| G0N819 | 10-255 | None |
| A0A1I7UN77 | 288-472 | None |
| A0A2G5UMT3 | 16-253 | None |
| A0A2G5UNH9 | 84-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.