DPCstruct | MC52787
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 407 ± 71 aa |
| Standard deviation of domain lengths | 70.93 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F8Q231 | 1-507 | MSVVARCKGLSGKDIAVNFLLMVNLMQLVTKCQSIKIRTDLSLNGIYNQEIAHLSNKPSKRMFQDWHSTGSKFAALAGGGSIYLLVL… |
| A0A4V1Q1X9 | 295-772 | YLALNCHENDVTESTVVFQGLLNAMEFAANVQICMKDSKGKKKRFTIFTQLEADSDGTLDKWWLNRYYSLGLKASMLAGAGSVYFLA… |
| F8Q5G5 | 118-538 | None |
| A0A067P532 | 3-413 | None |
| A0A409X020 | 345-694 | None |
| A0A067PDP5 | 1-346 | None |
| F8P111 | 158-664 | None |
| F8Q1M9 | 129-477 | None |
| A0A5C3K9P8 | 88-560 | None |
| A0A409YHV5 | 441-871 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.