DPCstruct | MC52781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 100 ± 10 aa |
| Standard deviation of domain lengths | 10.24 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F8PH14 | 1-102 | MTNNGWNNIIASRYQTAFDNKGQPQNAVPFIAVYDARNAFTVKNDMDAYPSRRLKMNNVVLMETFIKRYKWEKSVKHWQSWNVILEL… |
| A0A371CWE1 | 262-346 | RMMSRQPKGEDATIILPFTALYDARERFRPKKDMTAISPQAIGKGDLVLVETLVSRWKTSKDKKNRKGWSLWDVGFELQAISHLF |
| A0A165F8C7 | 7-124 | None |
| A0A1C7LQE5 | 86-188 | None |
| A0A401H4H2 | 60-150 | None |
| A0A0C9SZX7 | 44-153 | None |
| A0A0C9SRH0 | 197-301 | None |
| A0A1M2VCH3 | 89-178 | None |
| A0A1M2VC31 | 375-483 | None |
| A0A1M2VA25 | 467-556 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.