DPCstruct | MC5278
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 106 ± 10 aa |
| Standard deviation of domain lengths | 10.10 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 67.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.74 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 33.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07553 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L8SW14 | 11-120 | ENLGEDTTQSSVLPDIQQETAEIEAAPKAVPTKAETPADTLVELETIESSQPAKESASDVPSDYCSALRSAKSYSDRMHMSKAGIYD… |
| A0A2N6SYA9 | 1-102 | MLGGGDDATSTAADETTTTTDGNDAATPAPDAPAPAPAADPAPVEQEPAEEDVPEEFKSALRKADTYANAMHMSKAGLYDQLTSEYG… |
| A0A6B8SMH1 | 44-142 | None |
| D6XW10 | 27-137 | None |
| A0A133ZSQ7 | 14-115 | None |
| A0A2H1KL26 | 28-142 | None |
| A0A853EH34 | 58-180 | None |
| A0A387AQX1 | 274-361 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.