DPCstruct | MC52778
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 91 ± 7 aa |
| Standard deviation of domain lengths | 7.02 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 41.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287KT17 | 135-230 | VEYVAWLNTDKKPLHDPIAFRKELDGIIVDVSLQWCSDSYSDTVLGYANSIRTIDGGTHIEGLKTSLTRTINNFAKKSKIMKDKDIS… |
| A0A5N9W0D9 | 1-97 | IKSYVELLNENKEPIHDEPIYIHQSKDDIEVEIATQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKEEKD… |
| V9G8N7 | 97-192 | None |
| X1LDZ4 | 101-189 | None |
| A0A2X4TNJ4 | 57-148 | None |
| A0A540M343 | 327-409 | None |
| A0A0Q3PDM6 | 1-71 | None |
| A0A0E2IWR3 | 1-99 | None |
| A0A077ZFT4 | 234-329 | None |
| A0A7J6Z256 | 569-655 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.