DPCstruct | MC52772
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 265 ± 49 aa |
| Standard deviation of domain lengths | 49.18 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 70.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 29.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05623 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833RZX4 | 661-927 | DAHKVYQTSELVQSAFGGPFADYELLCHYASPVLNLPPHQIADAPLQKIWQWYEEPSCYTLEVKGCQDHHRFVDFTAHFVPSLSAVQ… |
| A0A6J1K5Q3 | 57-327 | FTLGELWDCYNEWSAYGAGIPIQSNGSETAMQFYVPYLSAIQIYTSKPVAPPRNRRYDSDMAECESDSWSDDSWSDNLSRSLSNNSS… |
| A0A0A9GJS6 | 1-226 | None |
| A0A0B0NYR9 | 2-152 | None |
| A0A834LMY8 | 4-234 | None |
| A0A3S3PKE7 | 846-1185 | None |
| A0A7J8YGE7 | 27-250 | None |
| A0A835KGC5 | 75-370 | None |
| A0A314YEQ6 | 217-516 | None |
| A0A2U1MKZ5 | 56-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.