DPCstruct | MC52771
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 154 ± 26 aa |
| Standard deviation of domain lengths | 25.91 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0XWE7 | 10-178 | SLMHPGMETKQPVAVTLTTPKAQELFTFLRSSYIDERSGLPRGIPQHEMRTDDIDGFPFYRPEPPKILGRLPELKPAVLYIFGKSSD… |
| A0A401KN76 | 820-971 | PSAVTLTTTKAQELFYFVRPSYVDERSGLPRGNPEEEMHPDDHDADYPFYRPESAWMFHRLPHLKPPILDLFGERSDLSSPTARQEK… |
| A0A4S9K921 | 244-390 | None |
| A0A3D8QDB2 | 27-181 | None |
| A0A401KD69 | 567-710 | None |
| Q2PIS2 | 1-129 | None |
| A0A6A6Z552 | 28-158 | None |
| B8NFU9 | 23-139 | None |
| A0A438NAF7 | 249-394 | None |
| W6XSE7 | 1-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.