DPCstruct | MC52769
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 82 ± 7 aa |
| Standard deviation of domain lengths | 7.03 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H5HM04 | 12-92 | SVHFTNTFQVNTLFSLCPLEVSQGVFRLDQRNQDAVIALGVYLLESEFQHLDRILPYLLKLLKALPKSVWLEDTFQLPTDS |
| A0A0K8UNG3 | 19-93 | ARIEPTPWDKVQSLFRYCPQENAAGVFCLDAKAQDAVIALGIYFLESGCQHEQHIVPYLLRLAKCLPKAVWVDDA |
| A0A7R9HL50 | 10-98 | None |
| A0A3Q3WCT9 | 30-107 | None |
| T1GS00 | 3-72 | None |
| A0A1S3WPJ9 | 202-275 | None |
| A0A821JCD2 | 13-105 | None |
| A0A2H1WSE5 | 1-89 | None |
| A0A2H1CQ09 | 14-102 | None |
| A0A2R7WW40 | 21-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.