DPCstruct | MC52766
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 156 ± 15 aa |
| Standard deviation of domain lengths | 15.28 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 27.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0642 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q8WXJ9 | 146-293 | SGITPLFYVAQTRQSNIFKILLQYGILEREKNPINIVLTIVLYPSRVRVMVDRELADIHEDAKTCLVLCSRVLSVISVKEIKTQLSL… |
| A0A4W5K9E4 | 5-150 | TPLMFVAQNRQYDVLKVLLQYGMLERERRPTYIIVSVLFNHPRLEVLDDRCHATVTKELRDCMALCFRVLSHVSMSDIEMQIVYGRT… |
| A0A3B4C0Y0 | 80-230 | None |
| A0A210R4E0 | 202-355 | None |
| A0A3R7LXG0 | 189-377 | None |
| A0A336LAI7 | 25-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.