DPCstruct | MC52759
Metacluster Properties and Pfam Annotations
| Number of structural domains | 101 |
|---|---|
| Mean domain length (aa) | 280 ± 74 aa |
| Standard deviation of domain lengths | 73.72 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 77.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 18.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F4YYN9 | 52-319 | QRMARTKIYGKENKGFERLNDVEAIALIPHRINFHVALYDLAETLSSSYLRYITGISEDHTLLSTTQPSEPILAFISAQDMLEDPGR… |
| A0A180G0T4 | 6-291 | NLTEYQALALLGTTIQPRLSGTLHLNSELVSSHAAHCDYISPGRDLILANYPSQFILASAANRTLADKEMLICCIKKLTVTLRLGLD… |
| A0A0C3D3B3 | 11-223 | None |
| A0A0F7RX27 | 564-883 | None |
| A0A7S0M8C7 | 648-878 | None |
| A0A1L9VSW0 | 350-557 | None |
| A0A7S1UTY1 | 4-212 | None |
| G4ZTF1 | 625-859 | None |
| A0A5C3ELI5 | 3-340 | None |
| A0A2S4WA44 | 285-589 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.