DPCstruct | MC52755
Metacluster Properties and Pfam Annotations
| Number of structural domains | 183 |
|---|---|
| Mean domain length (aa) | 209 ± 34 aa |
| Standard deviation of domain lengths | 34.40 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 15.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20231 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q2D1Q6 | 3-216 | AYSTIVNTLKVLGKHSKTLIADHARDPEKNGFIVFDNVQNYLRVRDHRFGRANTMNIGLAGTYCELPGVEAGALSFSEKKAQLALNK… |
| A0A0C4FCS1 | 58-260 | NTLSRRSRLQISSKLSKQVAPTLGAFLCFDNLDFEQRIQTKSVSQSNRMFHGTWGYIHHPNPKLVASVPSCELSLESYLQAMSKLET… |
| A0A397JAU9 | 530-799 | None |
| A0A2N0QYW4 | 99-324 | None |
| A0A397JBK5 | 618-853 | None |
| A0A6P8HML2 | 156-340 | None |
| A0A397JEY2 | 17-183 | None |
| A0A397JHZ6 | 184-450 | None |
| A0A397JRQ5 | 400-660 | None |
| A0A2B4SC88 | 4-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.