DPCstruct | MC52753
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 140 ± 29 aa |
| Standard deviation of domain lengths | 28.63 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 67.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 24.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C4FC78 | 1-126 | MVTFKAINNDSGADSDHCADNPADTITMTSSTAPLTNAPECLLQSFPPTRPPKTQHLRRAAADLTMRQFFFISYLAEDDEHTLATMQ… |
| A0A5B0R5E1 | 1-88 | MHLPGPPLIDPPAPPPVPEDLSLEDFMKLCKVDINNKQIQGLCEKHLIFHWSAFKGATQEKLEEIGFGFGPSALIVAGTLAAIRQIDK |
| A0A180GZ57 | 118-222 | None |
| A0A2S4W9Y2 | 108-238 | None |
| A0A2N5VGA0 | 40-131 | None |
| A0A2N5VRV8 | 96-199 | None |
| A0A2N5VWJ6 | 270-398 | None |
| A0A2S4UKY3 | 312-456 | None |
| A0A180G2Z5 | 439-580 | None |
| A0A180G5J5 | 8-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.