DPCstruct | MC52751
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 66 ± 7 aa |
| Standard deviation of domain lengths | 6.83 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 93.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 45.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9SLE7 | 7-64 | TFGFRMCEYVDHLHEHFMYPVAIQNASYMPPKDPGYSTEMKPESVSQYQFPGGDVWQK |
| A0A379Z4W9 | 28-85 | IDYLCIAGTHDGRVIEYVDHLHEHFVHPCEVKGAAYMPPLNPGYSIEMHAASLEQYRF |
| R4WTW8 | 8-76 | None |
| A0A182FF18 | 174-246 | None |
| A0A2V7Y948 | 582-646 | None |
| A0A0K2RLQ8 | 76-140 | None |
| A0A0B7NI55 | 528-591 | None |
| A0A3L8D2S7 | 497-564 | None |
| A0A7R8CZF2 | 436-511 | None |
| A0A822EWM5 | 2-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.