DPCstruct | MC52748
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 345 ± 27 aa |
| Standard deviation of domain lengths | 27.29 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 28.89 |
| Pfam Score | 60.00 |
| Assigned Pfam label(s) | PF11277- PF08689 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B4DDR8 | 172-508 | TVHAVILLEGTMNLTGETQSLVEQLTMVKRMQHIPTPLFVLEIWKACFVGLIESPEGTEELKWTAFTFLKIPQVLVKLKKYSHGDKD… |
| A0A2G9SIY7 | 1-333 | MLSSHSEQLHCTGFPTVHAIVMLEGTMNLTGEARPFVEQLNTVKRMQKIPSHLFLLEVWKACIVGLIESPAGTDELKWTAFTFLKIP… |
| U9TNW8 | 1-373 | None |
| A0A2P4Q6G1 | 1-373 | None |
| A0A2J7RQD3 | 231-569 | None |
| A0A6G0YZ34 | 451-741 | None |
| A0A397V815 | 1-367 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.