DPCstruct | MC52746
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 537 ± 107 aa |
| Standard deviation of domain lengths | 106.51 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.28 |
| Pfam Score | 80.42 |
| Assigned Pfam label(s) | PF21385- CL0105- PF08326 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9SEX8 | 1-580 | MQVARQSLTTYVIIMNNSHIEIDVHRLSDGGLLLSYDGNSYTTYMKEEVDRYRVTIGNKTCVFEKEKDPTVLRSPSTGKLLQYTVED… |
| A0A453AGY6 | 18-463 | RRHISLVHSTVSLNIEESKYTIETIRSGQGSYRLRMNGSVIEANVQTLCDGGLLMQLDGNSHVIYAEEEAGGTRLLIDGKTCLLQND… |
| A0A6N2LWH0 | 247-932 | None |
| A0A6I9XS55 | 445-946 | None |
| Q13085 | 685-1362 | None |
| K0ETW2 | 503-1052 | None |
| A0A7E4S774 | 315-900 | None |
| A0A183H5Z4 | 401-814 | None |
| A0A6I9XCZ9 | 193-590 | None |
| A0A1I8IGY0 | 218-638 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.