DPCstruct | MC52741
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 74 ± 10 aa |
| Standard deviation of domain lengths | 10.03 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 75.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9S930 | 1-77 | MSFVEMVEMVDILKRADYDGKHGPYPNPNVRKAKIMTKVVKSLQKNFVVRRSKDQLRKRWSDLKLREQDQYRRIKRV |
| A0A2G9Q140 | 103-184 | MSFKEMVEMVEILKNKDYDEKYGPYARPNLRKAKIMAKVVKTLHLSFGVRRSKDQIRKRWSDLKLRKPDQYRRIHKVLKKSK |
| A0A2G9SIY4 | 3-80 | None |
| A0A2G9RDG7 | 34-110 | None |
| A0A2G9SJC2 | 1-61 | None |
| A0A2G9SN60 | 1-79 | None |
| A0A2G9R5U5 | 62-124 | None |
| A0A2G9R8Q9 | 4-67 | None |
| A0A2G9R8U4 | 1-52 | None |
| A0A2G9RAH0 | 74-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.