DPCstruct | MC52733
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 81 ± 16 aa |
| Standard deviation of domain lengths | 15.53 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.18 |
| Pfam Score | 96.55 |
| Assigned Pfam label(s) | CL0491- PF15927- PF05781 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P2GXM7 | 3-64 | NPELRRQVINIYKELLFLGRNYPLGYEYFRNRLHKAFASQAHLTDDEQIRKGIARADFVKKG |
| A0A2G9S515 | 2-81 | ANPLRGEVVKLYKNLLYLGREYPKGEIYFKERLKRAFIKNKDVTDPEKIKELVARGEFVVKEIEALYYLRKYRAMKQRYY |
| A0A7R9UU61 | 3-99 | None |
| D3PIA0 | 17-110 | None |
| A0A3Q4MD92 | 1-59 | None |
| A0A4V2MXI4 | 50-146 | None |
| A0A0F7RUL3 | 78-200 | None |
| A0A803J9T2 | 84-162 | None |
| A0A1S8VS66 | 16-92 | None |
| Q7YWR3 | 1-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.