DPCstruct | MC52730
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 191 ± 31 aa |
| Standard deviation of domain lengths | 30.55 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 72.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9Y5A8 | 241-429 | AARSSHYCRYFLLPCCFFDFYGKYNRRQSQKSQYREYLDFVTEVGTVCGFQVEEDCLRIPSTKRVCLIGMSRTSPAARGDPALEAER… |
| G1TJ55 | 183-362 | AARSSYDCRFFVLPCCFFDFAGKYRRRQSRKTQYREYLDFVREVGVACGFHVQEDCLRIPSTKRVCLVGRSRTYPAAAEAELDEQRA… |
| A0A3M6UI26 | 39-282 | None |
| A0A6P6BK84 | 236-483 | None |
| A0A182WBK6 | 365-509 | None |
| A0A452CA76 | 136-329 | None |
| F4Q6F6 | 451-602 | None |
| E0W0J4 | 253-432 | None |
| A0A671QDI0 | 282-497 | None |
| A0A2U3YI13 | 438-630 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.