DPCstruct | MC5273
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 131 ± 23 aa |
| Standard deviation of domain lengths | 22.80 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 67.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 37.77 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | PF09280- CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0MFF3 | 3-157 | AVLAEGAGPLEFLRNMSQFVMMRQSVQQDPRLLPQLLQQIGRTNPQLLALINANQAEFVRLVNQPVTAEEYEASVRAAQQAMADMVE… |
| A0A7S0NGK0 | 1-132 | GGGGGGGGGGLPAGLPAALAQNPAMLEGLLQNPELLRQLMQSPEVQEMLQSPEAMAQLGINPEMLQAMMGGLAGGGGGGGGMMQIEV… |
| A0A0G4MRB3 | 695-826 | None |
| A0A6V7UN64 | 2-111 | None |
| A0A2H1C788 | 2-95 | None |
| U6M3U5 | 169-308 | None |
| A0A834ERU0 | 12-122 | None |
| A0A182E2P4 | 5-101 | None |
| A0A7G2ELJ1 | 569-706 | None |
| A0A287TR03 | 82-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.