DPCstruct | MC52729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 100 ± 17 aa |
| Standard deviation of domain lengths | 17.00 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0031 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9S0D7 | 2-96 | LLNVTLEGKLCGFIIDIRSEHYARQARSMGGGTENKDRYPDWKVLYHPLEKGRALQTSLTRLVAACYEPCLGINRWLTRLLTSRWMT… |
| A0A670ZXH0 | 244-339 | KLFIFDARQMSVADTNRAKGGGYESESGYPNMELIFLEIPNIHVMRESLRKLKEIVYPTIDESRWLSNVESTHWLEYIRMLLAGAVR… |
| A0A7M3RM31 | 2-80 | None |
| A0A813VXC3 | 233-328 | None |
| A0A6I9YG70 | 231-325 | None |
| D8LL65 | 500-603 | None |
| A0A4W4DXH8 | 217-309 | None |
| A0A6P4EEV9 | 367-467 | None |
| A0A6I8PLV7 | 220-324 | None |
| F0WT95 | 600-685 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.