DPCstruct | MC52727
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 122 ± 10 aa |
| Standard deviation of domain lengths | 9.71 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 44.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J8M103 | 1-108 | MDIDKDLEAPLYLTPKGWSLFLQRYYQVVHEGAELRHLDTQVQRCEDILQQLRAVVPQIDMEGDRNIWIVKPGAKSRGRGIMCMDHL… |
| A0A803JL23 | 3-123 | ICETYLNNKEHNDIDQKVSKLKSPELWKEFLHSYYRVIHDGASIDHAHLYAEQCRYLLNKLEAVFPQLDIEGGRNIWIVKPGARSQG… |
| A0A7J7ULQ0 | 1-136 | None |
| A0A3Q0FN97 | 117-245 | None |
| A0A6P3H713 | 1-111 | None |
| A0A183LTM7 | 98-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.