DPCstruct | MC52723
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 174 ± 17 aa |
| Standard deviation of domain lengths | 17.16 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A168KSV8 | 1-190 | MSQETCADELRVLSSFVADSDDRSAWPFIRRIKVSLNAHILSKGLVLVDLPGLRDLNAARRNITERYLRECDDIFAVCGIGRVTTDQ… |
| A0A6A6PFX1 | 99-282 | TLEALRKKIDPLTLSGRKFDQPALWPLIRQVSIFVRGPRILNDITIVDLPGISDTNESRANLTKEYIKSCDCVWIVSRIDRVVDDDT… |
| A0A4T0VHN7 | 12-185 | None |
| A0A177D2I4 | 5-196 | None |
| A0A1V8SH82 | 116-299 | None |
| M2MXV0 | 5-194 | None |
| A0A4Q4VV97 | 1-139 | None |
| A0A3N4I3K3 | 2-144 | None |
| A0A4W5RKD2 | 17-179 | None |
| A0A139IE92 | 17-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.