DPCstruct | MC52721
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 82 ± 12 aa |
| Standard deviation of domain lengths | 11.63 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.73 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 44.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12587 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A225TI18 | 120-205 | PVEIEPAPAPASAPAPAPAPAPAPDSGYSGGCGANSYVNVNGNSIPGPVQAPTAPAGASARCADGTYSFSQNRRGTCSGHGGVDEW |
| A0A3R6L8D4 | 95-147 | KYYTNSKGERVQSPTKYSSAPAGATALCRDGTYSFSRSRRGTCSHHGGVKKWL |
| A0A7G8A2M0 | 51-135 | None |
| A0A419G9N0 | 35-128 | None |
| A0A7K0D5S4 | 21-110 | None |
| A0A239Z1H5 | 245-320 | None |
| A0A3R8N6F4 | 3-66 | None |
| A0A2N8ME29 | 1-77 | None |
| A0A2W0D9Q0 | 79-146 | None |
| A0A1H0FB55 | 7-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.