DPCstruct | MC52714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 443 ± 64 aa |
| Standard deviation of domain lengths | 64.03 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 46.17 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | PF07492- CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H8Z8Z5 | 1-515 | MLGHCSRMNMYNKHNIRHTVHRRRVSCSLHTILKICTVKFVYKDIFIYFIVMREVTPTKGRRRTVQPEAIKEIPTRRKSAQINKARE… |
| A0A1D8PAJ7 | 2-354 | QFKVNIETNLQMLLLQEDTDGDKKITIEDKGPQKFELISTEGKSYLVNGTYHLSNLLQELVIAKNEGKTETIIPLSKIEEPPFDRIS… |
| A0A2I0S628 | 16-471 | None |
| A0A0L0T9Y0 | 5-461 | None |
| C9S5E5 | 1-416 | None |
| A0A3N4JHL0 | 11-394 | None |
| A0A139HTE8 | 244-799 | None |
| A0A0L0S5N8 | 11-568 | None |
| A0A3A2ZX30 | 1-462 | None |
| A0A1M7E679 | 393-771 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.