DPCstruct | MC52710
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 86 ± 3 aa |
| Standard deviation of domain lengths | 2.52 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 89.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 45.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W6MPU6 | 1-83 | MFEYLKSQNSIFDINDRSTWVERNLPFHSPHNVFLLYECSHEDFMWDVRAESGVLEAYSRLWDTEKLLISFDGFNLGFPHRPD |
| A0A0F4G6G8 | 1-85 | MFSWLEGFNLGFDRNDFSTVHKDKLPHITEKSMCLQYAVTHEDFAWAMRGEPGVVGAFEKVYDTEDLIVSFDAINFGFPNRKDNS |
| M7X1Q0 | 198-282 | None |
| A0A146EY67 | 84-170 | None |
| A0A1V6RMY5 | 54-141 | None |
| A0A0D2A7P4 | 16-98 | None |
| A0A427XL23 | 54-140 | None |
| A0A5N6YPF5 | 1-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.