DPCstruct | MC5271
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 199 ± 19 aa |
| Standard deviation of domain lengths | 19.24 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2RFQ2 | 2-171 | VYKKCQELGIPTVTLSRWAAYGSSVSTTLLDNLARTEHMVACNIRNVSESNLMKLWKKVNLAPSDPRREKLPDRCNREWFCRTFIEK… |
| A0A7S0HX45 | 2-194 | LAPEPSAQNNRLDLQAAISFYRRAQELSVPLVVISRHLSHACRVPAELFDILASHGGQLGKTVRDEQRESFNMLWERASAPSGDPSK… |
| A0A1L7X163 | 483-695 | None |
| B8CBZ2 | 780-970 | None |
| A0A7S1E9N5 | 11-184 | None |
| R1F9X6 | 196-407 | None |
| A0A194WS65 | 10-197 | None |
| R1E285 | 10-208 | None |
| A0A7S4HKK2 | 194-383 | None |
| K0TPZ8 | 10-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.