DPCstruct | MC52706
Metacluster Properties and Pfam Annotations
| Number of structural domains | 144 |
|---|---|
| Mean domain length (aa) | 213 ± 43 aa |
| Standard deviation of domain lengths | 43.20 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.07 |
| Pfam Score | 62.83 |
| Assigned Pfam label(s) | CL0466- CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A349EL29 | 35-244 | EIGAITSGFPADKAGIRLHDKILAVDGKTIYHWNQFARSVRESSGKPMKFAIERDNRRTSVTVSAIESSGTYVIGVQPFQNLVITKH… |
| A0A832PI87 | 32-216 | FSVAKSYVILIVNVLPNSAAKKAGFAVNDIIYSFNGKVFYDNASPTLAKDFYDYIISLPPGMYTAEVVRQAKKVNIAVSLPGSSVSP… |
| A0A7C1DX13 | 10-220 | None |
| A0A836RAD2 | 17-216 | None |
| A0A1F8P6V3 | 10-227 | None |
| C6XJV3 | 123-387 | None |
| A0A381E7N0 | 309-553 | None |
| A0A847N2E3 | 1-140 | None |
| A0A7C1SP00 | 2-120 | None |
| M1VAX0 | 171-418 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.