DPCstruct | MC5270
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 116 ± 10 aa |
| Standard deviation of domain lengths | 9.78 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 19.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R9VCJ1 | 2-104 | CFWVTLRPLFNGESERAAVVEDAYELNVFLSQATGVEIAQVQMLCPPSITGRPHWSLEELRKIVIHRGLESSQSAVIYETAVATYKL… |
| A0A0M3CMG5 | 1-106 | MLWKSASLNPDSYYFVVEGCGLVDGSLGPWVRLVSSVDEVDSLCRGEQVDTLSVNKIHLIAPPSMTKQAGISIQPLSDIRIKEGSEA… |
| A0A1F8W259 | 19-132 | None |
| A0A0E3C0N2 | 43-171 | None |
| A0A2A2KKT9 | 58-184 | None |
| A0A2V5B0K4 | 8-136 | None |
| A0A658GDT7 | 1-110 | None |
| A0A7Z6U2B9 | 75-180 | None |
| A0A2A2M1K1 | 26-132 | None |
| A0A327MPC9 | 17-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.