DPCstruct | MC527
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 253 ± 27 aa |
| Standard deviation of domain lengths | 27.25 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.84 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.40 |
| Mean intra-cluster sequence similarity (%) | 23.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E0HHJ2 | 41-320 | VIHVKAGETRELAPADGVLSLQRLVLEDNAVLSLAPGLGQVQIDVARAEIGRNVKIVARGEAGADGQPGASIPGQAPTCSAGKPGTA… |
| A0A368DQY2 | 122-331 | QGPLNLLYNGTDGINGKNQRNRGTPLLLRDGKDGEHGPDGTNGASANNYTAHLWRDSSFIYVHITEDISNHVYRYQMTSGNNIHFDL… |
| A0A848E831 | 254-492 | None |
| A0A014PES1 | 3-261 | None |
| A0A843YTW2 | 45-270 | None |
| A0A7Z1K0Y7 | 1-263 | None |
| A0A2X2JL56 | 146-370 | None |
| A0A7G5MNZ3 | 338-645 | None |
| A0A3E1NUT8 | 1-230 | None |
| H8MWX5 | 449-720 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.