DPCstruct | MC52693
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 166 ± 14 aa |
| Standard deviation of domain lengths | 13.76 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0Y3V1 | 1-162 | MTNNREIVQCLNIIKTDHSIKLIGKTFEKKMALYDNPADTSTFDIYTVDALSNVIKCWDYLEIKKKIMIIKHDNILVAMPILHTSLL… |
| A0A8B6FJP8 | 132-284 | SCVQIQGKICVVQNILQTADEIHLIYHKYRSESNFFETPLPSQSVGIKKLSRLGNTFRYATLEHVEAKCVLLPYRDHFVAFPLCDSV… |
| A0A6A5FQ95 | 121-302 | None |
| J9LPK0 | 372-531 | None |
| J9L7X3 | 131-304 | None |
| J9L304 | 612-776 | None |
| J9L0M4 | 352-534 | None |
| A0A6G0ZCX3 | 300-465 | None |
| X1WNT6 | 488-633 | None |
| A0A226D128 | 579-739 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.