DPCstruct | MC5269
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 100 ± 11 aa |
| Standard deviation of domain lengths | 11.28 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 36.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N7MJ77 | 4-96 | WLLKLLKKWQCLPSTMIDSHELDFARTVGKRLDEHRELIEDIERATGYFSSEAGQWSRGHALTQDDYLIKLYTLRHGQSPINDEYVR… |
| A0A083USW8 | 7-107 | QRLGFIRVAVVRDQLQFARNISKRLDEHREVVEQIQSQTNLFTECPWHVSHMATQDDYLMRIYRMVHGAWPDHSDEVHRQHWYGEFI… |
| A0A1B8TGZ7 | 8-140 | None |
| A0A855KN34 | 5-102 | None |
| A0A2N7IYP7 | 6-107 | None |
| A0A0Q0E868 | 101-199 | None |
| A0A7Z2MZG2 | 1-104 | None |
| F9RN57 | 9-103 | None |
| A0A4Q5VAG6 | 18-124 | None |
| A0A5N4FT68 | 4-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.