DPCstruct | MC52676
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 230 ± 47 aa |
| Standard deviation of domain lengths | 47.18 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07542 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A448ZEV8 | 130-421 | PKGDRTTRSLALEAMLVPRVPGAGPARETATSAAGDGESGGSSPSWYGVTLDGRTVSTPMGQTLAVPSETLAYMIAAEWDSQTKDLQ… |
| S9USD1 | 8-192 | EYAEQTGHINKLLMPMTDVCSGALHVAPQMIPPRLDYLMSFFQNDNMYFRAAPIAHQQDALIQPIADWVEKTYGLPVPRIVGIGHPN… |
| A0A1V4LYR9 | 160-379 | None |
| A0A2U1Q8L2 | 67-327 | None |
| D2VDZ9 | 139-409 | None |
| A0A7I7SQF1 | 58-288 | None |
| A0A7R9DDL3 | 6-203 | None |
| A0A183QJ85 | 1-179 | None |
| A0A6P5UCB2 | 125-353 | None |
| B9FUH3 | 50-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.