DPCstruct | MC52674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 238 ± 35 aa |
| Standard deviation of domain lengths | 34.71 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 38.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0UF75 | 287-502 | VPVADHADIDPKPCCHLSNIASSDSRPQAPTTDQLFLWETNIIALGVRHIDELGWVTLLRGPRARNDEKGLTLADFWSGTGNYFGKD… |
| A0A448YWB8 | 1-278 | MTQTLYKLRETAPETVPSDQLNNFYGTLTKDQLKRAYPGLMRVEVLLDEDKYGTQTELDPVPVFADKQDIDPRHCCHIEDFAVSENR… |
| A0A7S0C5T2 | 123-383 | None |
| A0A1E7EIV1 | 176-391 | None |
| A0A7S2E6W9 | 2-211 | None |
| B7G723 | 209-438 | None |
| A0A7S4T401 | 350-562 | None |
| A0A6V0CW97 | 196-424 | None |
| A0A7S2YTA5 | 7-338 | None |
| A0A7S4VTC3 | 126-339 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.