DPCstruct | MC52673
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 94 ± 9 aa |
| Standard deviation of domain lengths | 9.05 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 47.86 |
| Pfam Score | 99.21 |
| Assigned Pfam label(s) | PF01015- CL0235 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V6M581 | 1-105 | MAIGNNSNKKKKIVQRAKPDPFLRKEWYDVQAPTLFKKSDMGQTVVTKTSGMRVSTEVVKGRIVKANLGDLAENETQNGTSNFNFKI… |
| A0A662FLY1 | 4-91 | KKSSKVVKKKWFKILAPALLKESPVGETLLADPEQLLGKKMTVGLGSITGEPQKQHTHVNLLVKDYVDGVFKTELLGWRILPAAVKKL |
| L9KJE9 | 70-146 | None |
| A0A7J7F6Z8 | 105-204 | None |
| A0A7R8H0E4 | 9-106 | None |
| G1Q6J0 | 1-77 | None |
| A0A811Y9L3 | 1-67 | None |
| B7XQ34 | 13-118 | None |
| A0A2Y9QBD9 | 64-163 | None |
| A0A4D8XM49 | 101-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.