DPCstruct | MC52671
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 171 ± 26 aa |
| Standard deviation of domain lengths | 25.93 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07916 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H4G5R6 | 26-183 | TRLTSSAGNILGSIAAFPAFDSVRQALPMVQALLQMALVICIPLITLCSAWDVKAVITLTFVQFALFFLTFWWELARWLDSWLLDVL… |
| A0A0P9S262 | 2-134 | VMAFLKMALVICIPLVLVFGTYDLKVVMTISFMQFAFFFVDFWFQLARWVDSTILNALYGANAPHQNFNPVMGLNNTESDMLVNFVS… |
| A0A6H0JMG5 | 493-687 | None |
| A0A402XLK2 | 302-474 | None |
| W9TCP7 | 2-144 | None |
| A0A3M2WHV5 | 25-208 | None |
| A0A702FCR0 | 32-173 | None |
| A0A447JCJ9 | 23-207 | None |
| A0A3M5QGP3 | 191-402 | None |
| A0A0U4JWV9 | 44-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.