DPCstruct | MC5267
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 111 ± 6 aa |
| Standard deviation of domain lengths | 5.66 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6FR20 | 81-189 | FPQDGNKYVWGLFDGSGEPIEMTPVEYFARFVMDKDFTQAEQLGIDKIIRSGNALENIDEVFPNARYVDFHFEGSPENTGLDWGSLR… |
| A0A7C7EI11 | 1-112 | MTFFEDENLYLWGYYDGSGEEIKLTPAQYYDQFVYSADFINAEEIGYNEVLTSGNAIENQFEVYKDSIIVEYHIPGIDPKFEGLDWQ… |
| A0A285CM01 | 271-380 | None |
| A0A368YAK1 | 313-423 | None |
| A0A7C6J8K0 | 144-253 | None |
| A0A1S2LUS0 | 441-558 | None |
| A0A4Q0VVU7 | 282-386 | None |
| A0A2A4T9S5 | 164-276 | None |
| A0A6N8FIE2 | 585-693 | None |
| A0A3N5B9M8 | 180-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.