DPCstruct | MC52663
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 171 ± 14 aa |
| Standard deviation of domain lengths | 14.31 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 20.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0401 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M5Z8R0 | 1-166 | MAGRLTGDLSLGGNRARPAVSGELALRDGRATVPDLGITAERVRLSVRGDPSGELRLDGGARLGDGELVLDGVWAPTRSPLAVTLNL… |
| A0A7C7V939 | 480-640 | GKLSGDIKLRGTTDYPNLLGNATLHTNKLFAKLLGETFDSVDAYMEFDKNKIIITSFIARTEQSHVTGSGTIFLEPGSPITLDIKMD… |
| A0A1E5JL55 | 293-470 | None |
| A0A2X1PI91 | 139-300 | None |
| A0A536VPD4 | 605-773 | None |
| A0A444ISW5 | 23-183 | None |
| W7WP31 | 171-354 | None |
| A0A1V6IEU2 | 186-369 | None |
| A0A258JWU1 | 39-234 | None |
| A0A4U9U9H8 | 133-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.